Anti-imipenemase metallo-beta-lactamase (IMP), Rabbit mAb, Unconjugated

Catalog Number: BWT-MB67276
Article Name: Anti-imipenemase metallo-beta-lactamase (IMP), Rabbit mAb, Unconjugated
Biozol Catalog Number: BWT-MB67276
Supplier Catalog Number: MB67276
Alternative Catalog Number: BWT-MB67276-50UL,BWT-MB67276-100UL
Manufacturer: Bioworld Technology
Category: Antikörper
Application: ELISA, WB
Immunogen: MSKLSVFFIFLFCSIATAAEPLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVDAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFGGVNYWLVKNKIEVFYPGPGHTPDNLVVWLPERKILFGGCFIKPYGLGNLGDANLEAWPKSAKLLISKYGKAKLVVPSHSEAGDASLLKLTLEQAVKGLNESKKPSKLSNHHHHHH
Conjugation: Unconjugated
Rabbit IgG1, Kappa
UniProt: HAS1313528.1
Purity: The antibody was affinity-purified by protein A and the purity is > 95% (by SDS-PAGE).
Form: 1mg/ml in PBS,pH7.4
Application Dilute: WB: 1:500~1:2000 ELISA: 1:5000~10000
Application Notes: Using phage display technology, library of antibody was constructed from peripheral blood of New Zealand rabbits which had been immunized by IMP protein. Screening the library with recombinant IMP protein, the target antibody was obtained and then was purified by recombinant and expression.