Anti-Klebsiella pneumoniae carbapenemases (KPC), Rabbit mAb, Unconjugated

Catalog Number: BWT-MB67279
Article Name: Anti-Klebsiella pneumoniae carbapenemases (KPC), Rabbit mAb, Unconjugated
Biozol Catalog Number: BWT-MB67279
Supplier Catalog Number: MB67279
Alternative Catalog Number: BWT-MB67279-50UL,BWT-MB67279-100UL
Manufacturer: Bioworld Technology
Category: Antikörper
Application: ELISA, WB
Immunogen: SLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQA GLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQHHHHHH
Conjugation: Unconjugated
Rabbit IgG1, Kappa
UniProt: QBC89188.1
Purity: The antibody was affinity-purified by protein A and the purity is > 95% (by SDS-PAGE).
Form: 1mg/ml in PBS,pH7.4
Application Dilute: WB: 1:500~1:2000 ELISA: 1:5000~10000
Application Notes: Using phage display technology, library of antibody was constructed from peripheral blood of New Zealand rabbits which had been immunized by KPC protein. Screening the library with recombinant KPC protein, the target antibody was obtained and then was purified by recombinant and expression.