CD321 Recombinant Protein, E. coli

Catalog Number: BWT-NCP0316
Article Name: CD321 Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0316
Supplier Catalog Number: NCP0316
Alternative Catalog Number: BWT-NCP0316-500UG,BWT-NCP0316-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
Seems to play a role in epithelial tight junction formation. Appears early in primordial forms of cell junctions and recruits PARD3. The association of the PARD6-PARD3 complex may prevent the interaction of PARD3 with JAM1, thereby preventing tight junction assembly. Plays a role in regulating monocyte transmigration involved in integrity of epithelial barrier. Ligand for integrin alpha-L/beta-2 involved in memory T-cell and neutrophil transmigration. Involved in platelet activation.
Molecular Weight: ~26kDa
Tag: His-tag
UniProt: Q9Y624
Buffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: SVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRV TFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIPSSATIGN RAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDT GEYSCEARNGYGTPMTSNAVRMEAVERNVGV