CD369 Recombinant Protein, E. coli

Catalog Number: BWT-NCP0320
Article Name: CD369 Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0320
Supplier Catalog Number: NCP0320
Alternative Catalog Number: BWT-NCP0320-500UG,BWT-NCP0320-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
Dectin-1 is a C-type lectin receptor expressed by macrophages, monocytes, dendrtic cells, neutrophils, and a subset of gammadelta T cells. Dectin-1 is a glycoprotein with eight different isoforms, generated through alternative splicing. It plays an important role in anti-fungal immunity by acting as a pattern recognition receptor for beta-glucans found on the cell wall of fungi and some bacteria. Dectin-1 is composed of a short amino-terminal cytoplasmic domain containing an ITAM-like motif, a transmembrane domain, and an extracellular carboxy-terminal C-type lectin domain. Dectin-1 recognizes beta-glucans through its C-type lectin domain and transduces signals through its ITAM-like motif by recruiting and activating Syk. Dendritic cells activated through Dectin-1 promote differentiation of Th17 cells by producing IL-6 and IL-23.
Molecular Weight: ~21kDa
Tag: His-tag
UniProt: Q9BXN2
Buffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWI IYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSR PQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKF SM