CD94 Recombinant Protein, E. coli

Catalog Number: BWT-NCP0325
Article Name: CD94 Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0325
Supplier Catalog Number: NCP0325
Alternative Catalog Number: BWT-NCP0325-500UG,BWT-NCP0325-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
The activity of natural killer (NK) cells is regulated by members of multiple receptor families that recognize class I MHC molecules, such as the killer cell inhibitory receptor/leukocyte immunoglobulin-like receptor (KIR/LIR) family and the C-type lectin superfamily. The KIR/LIR family includes p91A (also designated pp130 or PIR-B, for paired immunoglobulin-like receptor-B) and p91B (also designated PIR-A). p91A acts as an inhibitory receptor through interactions with SHP-1, whereas p91B acts as an activating receptor. CD94, NKG2 and Ly-49 are members of the C-type lectin superfamily of type II membrane glycoproteins. CD94 forms heterodimers with NKG2 isoforms on the surface of NK cells, whereas Ly-49 isoforms form homodimers. NKG2-D, expressed on NK cells, gammadelta T cells, and CD8+ alphabeta T cells, is a receptor for the stress inducible protein MICA, an antigen frequently expressed in epithelial tumors.
Molecular Weight: ~19kDa
Tag: His-tag
UniProt: Q13241
Buffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: KNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCAS QKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKN CIAYNPNGNALDESCEDKNRYICKQQLI