CD327 Recombinant Protein, E. coli

Catalog Number: BWT-NCP0328
Article Name: CD327 Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0328
Supplier Catalog Number: NCP0328
Alternative Catalog Number: BWT-NCP0328-500UG,BWT-NCP0328-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
Two families of mammalian lectin-like adhesion molecules, the selectins and the sialoadhesins, bind glycoconjugate ligands in a sialic acid-dependent manner. The sialic acid-binding immunoglobulin superfamily lectins, designated Siglecs or sialoadhesins, recognize sialylated ligands and play a key role in mediating sialic-acid dependent binding to cells. Siglec-6, also called obesitybinding protein 1, is an adhesion molecule that is highly expressed in placental trophoblasts, as well as in peripheral blood leukocytes. Siglec-6 can bind both N-acetylneuraminic acid (Neu5Ac) and N-glycolylneuraminic acid (Neu5Gc), the two common sialic acids found in mammalian cells. Together with the other members of the Siglec family, Siglec-6 promotes cell-cell interactions and plays a roll in the innate and adaptive immune systems through glycan recognition.
Molecular Weight: ~35kDa
Tag: His-tag
UniProt: O43699
Buffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQ EETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTH RPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRP QDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLE GQALRLLCDAD