CD207 Recombinant Protein, E. coli

Catalog Number: BWT-NCP0340
Article Name: CD207 Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0340
Supplier Catalog Number: NCP0340
Alternative Catalog Number: BWT-NCP0340-500UG,BWT-NCP0340-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
Langerin (CD207) is a C-type lectin receptor whose expression is restricted mainly to dendritic cells in the skin including Langerhans cells in the epidermis and langerin+/CD103+ dermal dendritic cells. Langerin is found on the cell surface and within rod-shaped organelles called Birbeck granules, and its expression is required for the formation of Birbeck granules. Langerin recognizes carbohydrate motifs on the surface of pathogens, resulting in endocytosis of the pathogen into Birbeck granules, degradation of the pathogen, and antigen presentation to T cells.
Molecular Weight: ~35kDa
Tag: His-tag
UniProt: Q9UJ71
Buffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: PRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFL KLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKL LKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYK TAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQ AWNDAPCDKTF