CD299 Recombinant Protein, E. coli

Catalog Number: BWT-NCP0355
Article Name: CD299 Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0355
Supplier Catalog Number: NCP0355
Alternative Catalog Number: BWT-NCP0355-500UG,BWT-NCP0355-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
Dendritic cells (DC) are antigen-presenting immune system cells that are present on peripheral mucosal tissues and migrate to lymphoid tissues. DC-SIGN (DC-specific ICAM-3 grabbing nonintegrin) is a type II membrane protein that is exclusively expressed by DC. DC-SIGN, also designated CD209, binds to ICAM-3 to mediate the initial interaction between DC and resting T cells through the immunological synapse. The DC that are present in the initial sites of HIV-1 infection capture HIV-1 through DC-SIGN, which then facilitates the migration of DC to areas of T cell-rich secondary lymphoid organs, where it promotes efficient trans HIV-1 infection of these T cells. DC-SIGNR (DC-SIGNrelated molecule), also designated CD209L and L-SIGN (liver/lymph nodespecific ICAM-3 grabbing nonintegrin), is a type II integral membrane protein that is 77% identical to DC-SIGN. It is expressed on sinusoidal endothelial cells and binds the E2 glycoproteins of the hepatitis C virus.
Molecular Weight: ~38kDa
Tag: His-tag
UniProt: Q9H2X3
Buffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: MQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNR