CD85A Recombinant Protein, E. coli

Catalog Number: BWT-NCP0371
Article Name: CD85A Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0371
Supplier Catalog Number: NCP0371
Alternative Catalog Number: BWT-NCP0371-500UG,BWT-NCP0371-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM).
Molecular Weight: ~52kDa
Tag: His-tag
UniProt: O75022
Buffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQ