CD56 Recombinant Protein, E. coli

Catalog Number: BWT-NCP0377
Article Name: CD56 Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0377
Supplier Catalog Number: NCP0377
Alternative Catalog Number: BWT-NCP0377-500UG,BWT-NCP0377-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
NCAM (neural cell adhesion molecule, CD56) is an adhesion glycoprotein with five extracellular immunoglobulin-like domains followed by two fibronectin type III repeats. Structural diversity is introduced by alternative splicing resulting in different cytoplasmic domains. NCAM mediates neuronal attachment, neurite extension and cell-cell interactions through homo and heterophilic interactions. PSA (polysialic acid) post-translationally modifies NCAM and increases the metastatic potential of small cell lung carcinoma, Wilms+ tumor, neuroblastoma and rhabdomyosarcoma. CD56 is commonly used along with CD3 and CD16 to identify human NK cells (Mouse NK cells do not express CD56). Human natural killer cells are CD3-CD56+. The large subset with high CD16 expression are mature cytotoxic natural killer cells, while those with low CD16 expression are immature precursors and cytokine producers.
Molecular Weight: ~93kDa
Tag: His-tag
UniProt: P13591
Buffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: LQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTI