PDM1 Recombinant Protein, E. coli

Catalog Number: BWT-NCP0381
Article Name: PDM1 Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0381
Supplier Catalog Number: NCP0381
Alternative Catalog Number: BWT-NCP0381-500UG,BWT-NCP0381-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
DNA-binding regulatory protein implicated in early development. Involved in neuronal cell fate decision. Repressed directly or indirectly by the BX-C homeotic proteins.
Molecular Weight: ~66kDa
Tag: His-tag
UniProt: P31368
Buffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: mvmselrwhtaspednknslkrdllkstptsareaavhimqnryisrlsrspsplqsnasdcddnnssvgtssdrcrsplspalslshqqakrqlmslqphpahhhhnphhlnhlnhhqykqeedyddanggalnltsdnsrhstqspsnsvksataspvpvisvpspvppmispvlapsgcgsttpnsmaaaaaaaaavastmgsgispllalpgmsspqaqlaaaglgmnnplltgslspqdfaqfhqllqqr