CD301 Recombinant Protein, E. coli

Catalog Number: BWT-NCP0385
Article Name: CD301 Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0385
Supplier Catalog Number: NCP0385
Alternative Catalog Number: BWT-NCP0385-500UG,BWT-NCP0385-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
Probable role in regulating adaptive and innate immune responses. Binds in a calcium-dependent manner to terminal galactose and N-acetylgalactosamine units, linked to serine or threonine. These sugar moieties are known as Tn-Ag and are expressed in a variety of carcinoma cells.
Molecular Weight: ~30kDa
Tag: His-tag
UniProt: Q8IUN9
Buffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQES