CD303 Recombinant Protein, E. coli

Catalog Number: BWT-NCP0386
Article Name: CD303 Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0386
Supplier Catalog Number: NCP0386
Alternative Catalog Number: BWT-NCP0386-500UG,BWT-NCP0386-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells. Specifically recognizes non-sialylated galactose-terminated biantennary glycans containing the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. Binds to serum IgG. Efficiently targets ligand into antigen-processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium.
Molecular Weight: ~23kDa
Tag: His-tag
UniProt: Q8WTT0
Buffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI