beta-Actin Recombinant Protein, E. coli

Catalog Number: BWT-NCP0397
Article Name: beta-Actin Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0397
Supplier Catalog Number: NCP0397
Alternative Catalog Number: BWT-NCP0397-500UG,BWT-NCP0397-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
Actin, a ubiquitous eukaryotic protein, is the major component of the cytoskeleton. At least six isoforms are known in mammals. Nonmuscle beta- and gamma-actin, also known as cytoplasmic actin, are ubiquitously expressed, controlling cell structure and motility. While all actin isoforms are highly homologous, cytoplasmic beta- and gamma-actin protein sequences differ by only four biochemically similar amino acids. For this reason, antibodies raised to beta-actin may cross-react with gamma-actin, and vice versa. alpha-cardiac and alpha-skeletal actin are expressed in striated cardiac and skeletal muscles, respectively, two smooth muscle actins, alpha- and gamma-actin, are found primarily in vascular smooth muscle and enteric smooth muscle, respectively. These actin isoforms regulate the contractile potential of muscle cells. Actin exists mainly as a fibrous polymer, F-actin. In response to cytoskeletal reorganizing signals during processes such as cytokinesis, endocytosis, or stress, cofilin promotes fragmentation and depolymerization of F-actin, resulting in an increase in the monomeric globular form, G-actin. The ARP2/3 complex stabilizes F-actin fragments and promotes formation of new actin filaments. Research studies have shown that actin is hyperphosphorylated in primary breast tumors. Cleavage of actin under apoptotic conditions has been observed in vitro and in cardiac and skeletal muscle, as shown in research studies. Actin cleavage by caspase-3 may accelerate ubiquitin/proteasome-dependent muscle proteolysis.
Molecular Weight: ~43kDa
Tag: His-tag
UniProt: P60709
Buffer: PBS, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERF