CD258 Recombinant Protein, E. coli

Catalog Number: BWT-NCP0400
Article Name: CD258 Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0400
Supplier Catalog Number: NCP0400
Alternative Catalog Number: BWT-NCP0400-500UG,BWT-NCP0400-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
Tumor necrosis factor superfamily member 14 (TNFSF14), also known as CD258 and LIGHT, is a cell surface type II transmembrane protein that is expressed as a homotrimer. The extracellular region can be cleaved to generate a soluble cytokine. TNFSF14 is a ligand for the receptors herpesvirus entry mediator (HVEM) and lymphotoxin receptor (LTR). TNFSF14 is expressed on activated NK cells, activated T cells, activated monocytes, immature DCs, and mast cells. TNFSF14 interactions with HVEM induce potent co-stimulatory signaling in T cells and trigger NK cells to produce IFN-gamma via NF-kappaB RelA/p50 pathway signaling. TNFRSF14 produced by tumor-sensing NK cells aids in DC maturation, enabling de novo anti-tumor adaptive immune responses. TNFSF14-HVEM interactions are considered the main drivers of anti-tumor immune responses, whereas TNFSF14-LTR interactions have been characterized as maintaining the infrastructure that supports the anti-tumor response via lymphoid development and cancer cells susceptibility to the immune response. TNFSF14 induces the normalization of tumor vasculature, sensitizes tumor cells to IFN-gamma-mediated apoptosis, and results in a more inflamed tumor microenvironment (TME). Due to its effects on the TME and anti-tumor immune cell responses, TNFSF14 is being investigated as a target for immunotherapeutic intervention in cancer. TNFSF14 has also been implicated in the development and pathogenesis of inflammatory bowel disease and airway remodeling leading to asthma.
Molecular Weight: ~20kDa
Tag: His-tag
UniProt: O43557
Buffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: LQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV