TCL1A Recombinant Protein, E. coli

Catalog Number: BWT-NCP0422
Article Name: TCL1A Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0422
Supplier Catalog Number: NCP0422
Alternative Catalog Number: BWT-NCP0422-500UG,BWT-NCP0422-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
TCL1 (T cell leukemia 1), MTCP1 and TCL1b belong to the TCL1 proto-oncogene family, and their products are involved in Akt activation during embryonic development, T cell leukemias, prolymphocytic leukemias and B cell lymphomas. The Akt association domain of TCL1 binds with the PH domain of Akt. The formation of an oligomeric TCL-Akt complex is required for TCL1 coactivator function and results in phosphorylation and activation of Akt . Furthermore, functional analysis indicates that the interaction between TCL1 and Akt promotes translocation of Akt to the nucleus. These findings are supported by the crystal structure of TCL1, which suggests that TCL1 may participate in molecular transport.
Molecular Weight: ~17kDa
Tag: His-tag
UniProt: P56279
Buffer: 0.5M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD