E8L Recombinant Protein, E. coli

Catalog Number: BWT-NCP0424
Article Name: E8L Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0424
Supplier Catalog Number: NCP0424
Alternative Catalog Number: BWT-NCP0424-500UG,BWT-NCP0424-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , multiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus multiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.
Molecular Weight: ~39kDa
Tag: His-tag,Sumo-Tag
UniProt: Q5IXS0
Buffer: 2M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: HMPQQLSPINIETKKAISDARLKTLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSTIHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGIIIIAIFLQVSDHKNVYFQKIVNQLDSIRSANMSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADAAWIIFPTPINIHSDQLSKFRTLLSSSNHEGKPHYITENYRNPYKLNDDTQVYYSGEIIRAATTSPVRENYFMKW