Nanog Recombinant Protein, E. coli

Catalog Number: BWT-NCP0438
Article Name: Nanog Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0438
Supplier Catalog Number: NCP0438
Alternative Catalog Number: BWT-NCP0438-500UG,BWT-NCP0438-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
Nanog is a homeodomain-containing transcription factor that is essential for the maintenance of pluripotency and self renewal in embryonic stem cells. Nanog expression is controlled by a network of factors including Sox2 and the key pluripotency regulator Oct-4. Recent advances in somatic cell reprogramming have utilized viral expression of combinations of transcription factors including nanog, Oct-4, Sox2, KLF4, c-Myc, and LIN28.
Molecular Weight: ~40kDa
Tag: His-tag
UniProt: Q9H9S0
Buffer: 0.5M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: HMSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQF