Recombinant Human Fractalkine (rHuFractalkine/CX3CL1)

Catalog Number: BWT-PR1032
Article Name: Recombinant Human Fractalkine (rHuFractalkine/CX3CL1)
Biozol Catalog Number: BWT-PR1032
Supplier Catalog Number: PR1032
Alternative Catalog Number: BWT-PR1032-5UG,BWT-PR1032-20UG,BWT-PR1032-1.0MG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Fractalkine, also named neurotactin, is a novel chemokine recently identified through bioinformatics. Fractalkine has a unique C-X3-C cysteine motif near the amino-terminus and is the first member of a fourth branch of the chemokine superfamily. Unlike o
Molecular Weight: 8.5 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids and comprises only the chemokine domain of Human Fractalkine.
Source: Escherichia coli.
Purity: >97% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG
Formula: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio