Recombinant Human GRO-beta (rHuGRO-beta/ CXCL2 )

Catalog Number: BWT-PR1037
Article Name: Recombinant Human GRO-beta (rHuGRO-beta/ CXCL2 )
Biozol Catalog Number: BWT-PR1037
Supplier Catalog Number: PR1037
Alternative Catalog Number: BWT-PR1037-2UG,BWT-PR1037-10UG,BWT-PR1037-1.0MG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
The three GRO cDNAs encode 107 amino acid precursor proteins from which the N-terminal 34 amino acid residues are cleaved to generate the mature GROs. There are no potential N-linked glycosylation sites in the amino acid sequences. GRO expression is inducible by serum or PDGF and/or by a variety of inflammatory mediators, such as IL-1 and TNF, in monocytes, fibroblasts, melanocytes and epithelial cells. In certain tumor cell lines, GRO is expressed constitutively.Similar to other alpha chemokines, the three GRO proteins are potent neutrophil attractants and activators. In addition, these chemokines are also active toward basophils. All three GROs can bind with high affinity to the IL-8 receptor type B.
Molecular Weight: 7.9 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids.
Source: Escherichia coli.
Purity: >97% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Formula: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.