Recombinant Human Keratinocye Growth Factor-1 (rHuKGF-1)

Catalog Number: BWT-PR1079
Article Name: Recombinant Human Keratinocye Growth Factor-1 (rHuKGF-1)
Biozol Catalog Number: BWT-PR1079
Supplier Catalog Number: PR1079
Alternative Catalog Number: BWT-PR1079-2UG,BWT-PR1079-10UG,BWT-PR1079-1.0MG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Keratinocyte Growth Factor-1 (KGF-1/FGF-7) is one of 23 known members of the FGF family. All FGFs have two conserved cysteine residues and share 30 - 50% sequence identity at the amino acid level. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of variety of tissues, by promoting cellular proliferation and differentiation. KGF-1/FG-7 is a mitogen factor specific for epithelial cells and keratinocytes and signals through FGFR 2b. KGF-1/FGF-7 plays a role in kidney and lung development, angiogenesis, and wound healing.
Molecular Weight: Approximately 19.0 kDa, a single, non-glycosylated polypeptide chain containing 164 amino acids.
Source: Escherichia coli.
Purity: >96% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQK GIPVRGKKTK KEQKTAHFLP MAIT
Formula: Lyophilized from a 0.2mm filtered solution in 20mM PB, pH 8.0, 1M NaCl.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.