Recombinant Human MCP-4 (rHuMCP-4/CCL13 )

Catalog Number: BWT-PR1088
Article Name: Recombinant Human MCP-4 (rHuMCP-4/CCL13 )
Biozol Catalog Number: BWT-PR1088
Supplier Catalog Number: PR1088
Alternative Catalog Number: BWT-PR1088-5UG,BWT-PR1088-20UG,BWT-PR1088-1.0MG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
CCL13 is a chemoattractant for monocytes and eosinophils, and activates basophils. In addition, it has been reported to be chemotactic for CD4+ and CD8+ T cells, with an activity almost equivalent to that of MCP-3. The bioactivities of CCL13 is most likely mediated by the CC chemokine receptors CCR-2 and CCR-3, both of which have been shown to bind CCL13.
Molecular Weight: 8.6 kDa, a single non-glycosylated polypeptide chain containing 75 amino acids.
Source: Escherichia coli.
Purity: >96% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Formula: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.