Recombinant Human Migration Inhibitor Factor (rHuMIF) Preis auf Anfrage

Catalog Number: BWT-PR1093
Article Name: Recombinant Human Migration Inhibitor Factor (rHuMIF) Preis auf Anfrage
Biozol Catalog Number: BWT-PR1093
Supplier Catalog Number: PR1093
Alternative Catalog Number: BWT-PR1093-10UG,BWT-PR1093-50UG,BWT-PR1093-1.0MG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Human MIF consists of two alpha-helices and six beta-strands, four of which form a beta-sheet. The two remaining beta-strands interact with other MIF molecules, creating a trimer. Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory). Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position 1. Amino acids 50 - 65 have also been suggested to contain thiol-protein oxidoreductase activity. MIF has proinflammatory cytokine activity centered around aas 49 - 65. On fibroblasts, MIF induces, IL-1, IL-8 and MMP expression, on macrophages, MIF stimulates NO production and TNF-alpha release folllowing IFN-gamma activation. MIF apparently acts through CD74 and CD44, likely in some form of trimeric interaction. Human MIF is active on mouse cells. Human MIF is 90%, 94%, 95%, and 90% aa identical to mouse, bovine, porcine and rat MIF, respectively.
Molecular Weight: Approximately 13.5 kDa, a single non-glycosylated polypeptide chain containing 123 amino acids.
Source: Escherichia coli
Purity: >95% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALE
Formula: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.