Recombinant Human Otoraplin (rHuOTOR)

Catalog Number: BWT-PR1107
Article Name: Recombinant Human Otoraplin (rHuOTOR)
Biozol Catalog Number: BWT-PR1107
Supplier Catalog Number: PR1107
Alternative Catalog Number: BWT-PR1107-5UG,BWT-PR1107-20UG,BWT-PR1107-500UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member of the MIA/OTOR family. Members of this family which also includes MIA, MIA2, and TANGO share a Src homology-3 (SH3)-like domain. OTOR is predominantly expressed in the cochlea of the inner-ear and to a lesser extent in fetal brain and in some cartilage tissues. OTOR appears to be involved in early chondrogenesis of the otic capsule, which is required for normal inner ear development and auditory function.
Molecular Weight: 12.7 kDa, a single non-glycosylated polypeptide chain containing 112 amino acids.
Source: Escherichia coli
Purity: Sterile Filtered White lyophilized (freeze-dried) powder.Data Not Available.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: MVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMG VVGYFPRNLV KEQRVYQEAT KEVPTTDIDF FCE
Formula: Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.