Recombinant Mouse Leukemia inhibitory factor(rMuLIF) Preis auf Anfrage

Product Overview

• Article Name: Recombinant Mouse Leukemia inhibitory factor(rMuLIF) Preis auf Anfrage
• Biozol Catalog Number: BWT-PR2005
• Supplier Catalog Number: PR2005
• Alternative Catalog Number: BWT-PR2005-5UG,BWT-PR2005-10UG,BWT-PR2005-1.0MG
• Manufacturer: Bioworld Technology
• Category: Proteine/Peptide

Product Description

Leukemia Inhibitory Factor (LIF) is a lymphoid factor which promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. LIF has a number of other activities including cholinergic neuron differentiation, control of stem cell pluripotency,bone and fat metabolism, mitogenesis of certain factor dependent cell lines and promotion of megakaryocyte production in vivo. Mouse LIF is a 20 kDa protein containing 181 amino acid residues.

Product Properties

• Molecular Weight: Approximately20 kDa, a single non-glycosylated polypeptide chain containing 181 amino acids.
• Source: Escherichia coli.
• Purity: >98% by SDS-PAGE and HPLC analyses.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
• Formula: Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4, with 0.02% TWEEN 20.

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.