Recombinant Mouse Leukemia inhibitory factor(rMuLIF) Preis auf Anfrage

Catalog Number: BWT-PR2005
Article Name: Recombinant Mouse Leukemia inhibitory factor(rMuLIF) Preis auf Anfrage
Biozol Catalog Number: BWT-PR2005
Supplier Catalog Number: PR2005
Alternative Catalog Number: BWT-PR2005-5UG,BWT-PR2005-10UG,BWT-PR2005-1.0MG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Leukemia Inhibitory Factor (LIF) is a lymphoid factor which promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. LIF has a number of other activities including cholinergic neuron differentiation, control of stem cell pluripotency,bone and fat metabolism, mitogenesis of certain factor dependent cell lines and promotion of megakaryocyte production in vivo. Mouse LIF is a 20 kDa protein containing 181 amino acid residues.
Molecular Weight: Approximately20 kDa, a single non-glycosylated polypeptide chain containing 181 amino acids.
Source: Escherichia coli.
Purity: >98% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Formula: Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4, with 0.02% TWEEN 20.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.