Recombinant Murine Fibroblast Growth Factor-basic (rMubFGF )

Catalog Number: BWT-PR2015
Article Name: Recombinant Murine Fibroblast Growth Factor-basic (rMubFGF )
Biozol Catalog Number: BWT-PR2015
Supplier Catalog Number: PR2015
Alternative Catalog Number: BWT-PR2015-10UG,BWT-PR2015-50UG,BWT-PR2015-1.0MG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
FGF basic (FGF-2, HBGF-2) is one of at least 22 mitogenic proteins of the FGF family, which show 35 - 60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. Storage pools within the cell or on cell surface heparan sulfate proteoglycans (HSPG) are likely. The predicted 17 kDa FGF basic isoform can be located in both the cytoplasm and the nucleus and is presumed to be the form secreted. Transcription from alternate start sites produces 21 - 24 kDa forms found only in the nucleus. High and low molecular weight human FGF basic targets the expression of different genes when expressed in NIH-3T3 cells.
Molecular Weight: Approximately 16.2 kDa, a single non-glycosylated polypeptide chain containing 146 amino acids.
Source: Escherichia coli.
Purity: >98% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Formula: Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.