Recombinant Murine NOGGIN (rMuNOGGIN )

Catalog Number: BWT-PR2032
Article Name: Recombinant Murine NOGGIN (rMuNOGGIN )
Biozol Catalog Number: BWT-PR2032
Supplier Catalog Number: PR2032
Alternative Catalog Number: BWT-PR2032-5UG,BWT-PR2032-20UG,BWT-PR2032-1.0MG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Noggin belongs to a group of diffusible proteins which bind to ligands of the TGF-beta family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-beta ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Noggin was originally identified as a BMP-4 antagonist whose action is critical for proper formation of the head and other dorsal structures. Consequently, Noggin has been shown to modulate the activities of other BMPs including BMP-2,-7,-13, and -14. Targeted deletion of Noggin in mice results in prenatal death and recessive phenotype displaying a severely malformed skeletal system. Conversely, transgenic mice over-expressing Noggin in mature osteoblasts display impaired osteoblastic differentiation, reduced bone formation, and severe osteoporosis.
Molecular Weight: Approximately 46.4 kDa disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains.
Source: Escherichia coli.
Purity: >95% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSV PEGMVCKPSK SVHLTVLRWR CQRRGGQRCG WIPIQYPIIS ECKCSC
Formula: Lyophilized from a 0.2µm filtered concentrated solution in 30% acetonitrile, 0.1% TFA.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.