Recombinant Murine Tumor Necrosis Factor-alpha (rMuTNF-alpha)

Catalog Number: BWT-PR2036
Article Name: Recombinant Murine Tumor Necrosis Factor-alpha (rMuTNF-alpha)
Biozol Catalog Number: BWT-PR2036
Supplier Catalog Number: PR2036
Alternative Catalog Number: BWT-PR2036-5UG,BWT-PR2036-20UG,BWT-PR2036-1.0MG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Tumor necrosis factor alpha (TNF-alpha) is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. Mouse TNF-alpha occurs as a membrane-anchored form. The naturally-occurring form of TNF-alpha is glycosylated, but non-glycosylated recombinant TNF-alpha has comparable biological activity. The biologically active native form of TNF-alpha is reportedly a trimer. Human and murine TNF-alpha show approximately 79% homology at the amino acid level and crossreactivity between the two species.
Molecular Weight: Approximately 17.3 kDa. The recombinant murine TNF-alpha is a soluble 157 amino acid protein which corresponds to C-terminal extracellular domain of the full length transmembrane protein.
Source: Escherichia coli.
Purity: >97% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVY SQVLFKGQGC PDYVLLTHTV SRFAISYQEKVNLLSAVKSP CPKDTPEGAE LKPWYEPIYL GGVFQLEKGD QLSAEVNLPK YLDFAESGQV YFGVIAL
Formula: Lyophilized from a 0.2mm filtered solution in PBS, pH 7.2.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.