Human DCT protein

Catalog Number: BYT-ORB10015
Article Name: Human DCT protein
Biozol Catalog Number: BYT-ORB10015
Supplier Catalog Number: orb10015
Alternative Catalog Number: BYT-ORB10015-1, BYT-ORB10015-100, BYT-ORB10015-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: L-dopachrome Delta-isomerase Tyrosinase-related protein 2
This Human DCT protein spans the amino acid sequence from region 24-472a. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 71.3 kDa
UniProt: P40126
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSR
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 24-472aSequence Info: Topological Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.