Human DCT protein

Catalog Number: BYT-ORB10015
Article Name: Human DCT protein
Biozol Catalog Number: BYT-ORB10015
Supplier Catalog Number: orb10015
Alternative Catalog Number: BYT-ORB10015-1,BYT-ORB10015-100,BYT-ORB10015-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: L-dopachrome Delta-isomerase Tyrosinase-related protein 2
Recombinant of human DCT protein
Molecular Weight: 71.3 kDa
UniProt: P40126
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNS
Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 24-472aSequence Info: Topological Domain