Human HLA-DRB1 protein

Catalog Number: BYT-ORB10060
Article Name: Human HLA-DRB1 protein
Biozol Catalog Number: BYT-ORB10060
Supplier Catalog Number: orb10060
Alternative Catalog Number: BYT-ORB10060-1,BYT-ORB10060-100,BYT-ORB10060-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: MHC class II antigen DRB1*1
Recombinant of human HLA-DRB1 protein
Molecular Weight: 42.9 kDa
UniProt: P04229
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK
Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 30-227aaSequence Info: Extracellular DomainGlycerol content: 0.5