Rat Sult1a1 protein

Product Overview

• Article Name: Rat Sult1a1 protein
• Biozol Catalog Number: BYT-ORB10081
• Supplier Catalog Number: orb10081
• Alternative Catalog Number: BYT-ORB10081-1,BYT-ORB10081-100,BYT-ORB10081-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Aryl sulfotransferase Aryl sulfotransferase IV

Product Description

This Rat Sult1a1 protein spans the amino acid sequence from region 1-291aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 53.9 kDa
• UniProt: P17988
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Rattus norvegicus (Rat)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKG

Application Notes

• Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-291aaSequence Info: Full LengthGlycerol content: 0.5

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sult1a1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sult1a1.