Rat Sult1a1 protein

Catalog Number: BYT-ORB10081
Article Name: Rat Sult1a1 protein
Biozol Catalog Number: BYT-ORB10081
Supplier Catalog Number: orb10081
Alternative Catalog Number: BYT-ORB10081-1,BYT-ORB10081-100,BYT-ORB10081-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Rat
Alternative Names: Aryl sulfotransferase Aryl sulfotransferase IV
Recombinant of rat Sult1a1 protein
Molecular Weight: 53.9 kDa
UniProt: P17988
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRK
Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-291aaSequence Info: Full LengthGlycerol content: 0.5