Human ATP5B protein

Catalog Number: BYT-ORB10177
Article Name: Human ATP5B protein
Biozol Catalog Number: BYT-ORB10177
Supplier Catalog Number: orb10177
Alternative Catalog Number: BYT-ORB10177-20,BYT-ORB10177-100,BYT-ORB10177-500,BYT-ORB10177-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: ATP 5B, ATP synthase H+ transporting mitochondrial F1 complex beta polypeptide, ATP synthase subunit beta mitochondrial, ATP synthase subunit beta, mitochondrial, atp5b, ATPB, ATPB_HUMAN, ATPMB, ATPSB, Epididymis secretory protein Li 271, HEL-S-271, Mito
Recombinant of human ATP5B protein
Molecular Weight: 53.8 kDa
UniProt: P06576
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AQTSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDV
Application Notes: Tag info: N-terminal 6xHis-taggedExpression Region: 48-529aaSequence Info: FulllengthofmatureproteinGlycerol content: 0.5