Bacterial mdh protein

Product Overview

• Article Name: Bacterial mdh protein
• Biozol Catalog Number: BYT-ORB10196
• Supplier Catalog Number: orb10196
• Alternative Catalog Number: BYT-ORB10196-1,BYT-ORB10196-100,BYT-ORB10196-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: mdh, BAbS19_I18080, Malate dehydrogenase, EC 1.1.1.37

Product Description

This Bacterial mdh protein spans the amino acid sequence from region 1-320aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 53.7 kDa
• UniProt: B2S881
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Brucella abortus (strain S19)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MARNKIALIGSGMIGGTLAHLAGLKELGDVVLFDIAEGTPQGKGLDIAESSPVDGFDAKFTGANDYAAIEGADVVIVTAGVPRKPGMSRDDLLGINLKVMEQVGAGIKKYAPEAFVICITNPLDAMVWALQKFSGLPAHKVVGMAGVLDSARFRYFLSEEFNVSVEDVTVFVLGGHGDSMVPLARYSTVAGIPLPDLVKMGWTSQDKLDKIIQRTRDGGAEIVGLLKTGSAFYAPAASAIQMAESYLKDKKRVLP

Application Notes

• Application Notes: Biological Origin: Brucella abortus (strain S19). Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-320aaSequence Info: Full LengthGlycerol content: 0.5

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Brucella abortus (strain S19) mdh.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Brucella abortus (strain S19) mdh.