Bacterial mdh protein

Catalog Number: BYT-ORB10196
Article Name: Bacterial mdh protein
Biozol Catalog Number: BYT-ORB10196
Supplier Catalog Number: orb10196
Alternative Catalog Number: BYT-ORB10196-1,BYT-ORB10196-100,BYT-ORB10196-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Bacteria
Alternative Names: mdh, BAbS19_I18080, Malate dehydrogenase, EC 1.1.1.37
Recombinant of bacterial mdh protein
Molecular Weight: 53.7 kDa
UniProt: B2S881
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Brucella abortus (strain S19)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MARNKIALIGSGMIGGTLAHLAGLKELGDVVLFDIAEGTPQGKGLDIAESSPVDGFDAKFTGANDYAAIEGADVVIVTAGVPRKPGMSRDDLLGINLKVMEQVGAGIKKYAPEAFVICITNPLDAMVWALQKFSGLPAHKVVGMAGVLDSARFRYFLSEEFNVSVEDVTVFVLGGHGDSMVPLARYSTVAGIPLPDLVKMGWTSQDKLDKIIQRTRDGGAEIVGLLKTGSAFYAPAASAIQMAESYLKDKKRVL
Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-320aaSequence Info: Full LengthGlycerol content: 0.5