Sheep IL4 protein

Product Overview

• Article Name: Sheep IL4 protein
• Biozol Catalog Number: BYT-ORB10205
• Supplier Catalog Number: orb10205
• Alternative Catalog Number: BYT-ORB10205-1,BYT-ORB10205-100,BYT-ORB10205-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: B-cell stimulatory factor 1

Product Description

This Sheep IL4 protein spans the amino acid sequence from region 25-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 29.6 kDa
• UniProt: P30368
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Ovis aries (Sheep)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC

Application Notes

• Application Notes: Biological Origin: Ovis aries (Sheep). Application Notes: Tag info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-taggedExpression Region: 25-135aaSequence Info: Full Length of MatureProtein

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Ovis aries (Sheep) IL4.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Ovis aries (Sheep) IL4.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.