Sheep IL4 protein

Product Overview

• Article Name: Sheep IL4 protein
• Biozol Catalog Number: BYT-ORB10205
• Supplier Catalog Number: orb10205
• Alternative Catalog Number: BYT-ORB10205-1,BYT-ORB10205-100,BYT-ORB10205-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Species Reactivity: Sheep
• Alternative Names: B-cell stimulatory factor 1

Product Description

Recombinant of sheep IL4 protein

Product Properties

• Molecular Weight: 29.6 kDa
• UniProt: P30368
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Ovis aries (Sheep)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC

Application Notes

• Application Notes: Tag info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-taggedExpression Region: 25-135aaSequence Info: Full Length of MatureProtein