Zebrafish sod1 protein

Catalog Number: BYT-ORB10292
Article Name: Zebrafish sod1 protein
Biozol Catalog Number: BYT-ORB10292
Supplier Catalog Number: orb10292
Alternative Catalog Number: BYT-ORB10292-1,BYT-ORB10292-100,BYT-ORB10292-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Fish
Alternative Names: sod1, cuzn, Superoxide dismutase [Cu-Zn], EC 1.15.1.1
Recombinant of zebrafish sod1 protein
Molecular Weight: 37.1 kDa
UniProt: O73872
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Danio rerio (Zebrafish) (Brachydanio rerio)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ
Application Notes: Tag info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-154aaSequence Info: Full Length Glycerol content: 0.5