Human HLA G protein

Catalog Number: BYT-ORB10317
Article Name: Human HLA G protein
Biozol Catalog Number: BYT-ORB10317
Supplier Catalog Number: orb10317
Alternative Catalog Number: BYT-ORB10317-1,BYT-ORB10317-100,BYT-ORB10317-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: HLA G antigen MHC class I antigen G
Recombinant of human HLA G protein
Molecular Weight: 39.6 kDa
UniProt: P17693
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEE
Application Notes: Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 25-338aaSequence Info: partial