Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active)

Catalog Number: BYT-ORB1095869
Article Name: Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active)
Biozol Catalog Number: BYT-ORB1095869
Supplier Catalog Number: orb1095869
Alternative Catalog Number: BYT-ORB1095869-1,BYT-ORB1095869-100,BYT-ORB1095869-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (4-1BB ligand receptor) (CDw137) (T-cell antigen 4-1BB homolog) (T-cell antigen ILA) (CD antigen CD137)
This Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active) spans the amino acid sequence from region 24-186aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 19.1 kDa
UniProt: Q07011
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized TNFRSF9 at 2 µg/mL can bind TNFSF9, the EC50 is 1.011-2.429 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized TNFRSF9 at 2 µg/ml can bind TNFSF9, the EC50 is 1.011-2.429 ng/mL.