Recombinant Human Tyrosine-protein kinase Mer (MERTK), partial (Active)

Product Overview

• Article Name: Recombinant Human Tyrosine-protein kinase Mer (MERTK), partial (Active)
• Biozol Catalog Number: BYT-ORB1095871
• Supplier Catalog Number: orb1095871
• Alternative Catalog Number: BYT-ORB1095871-1,BYT-ORB1095871-100,BYT-ORB1095871-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: (Proto-oncogene c-Mer) (Receptor tyrosine kinase MerTK)

Product Description

This Recombinant Human Tyrosine-protein kinase Mer (MERTK), partial (Active) spans the amino acid sequence from region 21-505aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 55.4 kDa
• UniProt: Q12866
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 0.2 M Arginine, 6% Trehalose, pH 8.0
• Source: Homo sapiens (Human)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: AITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVPNIYQDTTISWWKDGKELLGAHHAITQFYPDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKG

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized MERTK at 2 µg/mL can bind anti-MERTK antibody, the EC50 is 32.95-48.25 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized MERTK at 2 µg/ml can bind anti-MERTK antibody, the EC50 is 32.95-48.25 ng/mL.