Recombinant Human papillomavirus type 16 Protein E7 (E7) (Active)

Product Overview

• Article Name: Recombinant Human papillomavirus type 16 Protein E7 (E7) (Active)
• Biozol Catalog Number: BYT-ORB1095874
• Supplier Catalog Number: orb1095874
• Alternative Catalog Number: BYT-ORB1095874-1,BYT-ORB1095874-100,BYT-ORB1095874-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Protein E7

Product Description

This Recombinant Human papillomavirus type 16 Protein E7 (E7) (Active) spans the amino acid sequence from region 1-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 16.3 kDa
• UniProt: P03129
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Human papillomavirus type 16
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Application Notes

• Application Notes: Biological Origin: Human papillomavirus type 16. Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized HPV16 E7 at 10 µg/mL can bind Biotinylated MYC, the EC50 is 268.1-354.3 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized HPV16 E7 at 10 µg/ml can bind Biotinylated MYC, the EC50 is 268.1-354.3 ng/mL.