Recombinant Human papillomavirus type 16 Protein E7 (E7) (Active)

Catalog Number: BYT-ORB1095874
Article Name: Recombinant Human papillomavirus type 16 Protein E7 (E7) (Active)
Biozol Catalog Number: BYT-ORB1095874
Supplier Catalog Number: orb1095874
Alternative Catalog Number: BYT-ORB1095874-1,BYT-ORB1095874-100,BYT-ORB1095874-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein E7
This Recombinant Human papillomavirus type 16 Protein E7 (E7) (Active) spans the amino acid sequence from region 1-98aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 16.3 kDa
UniProt: P03129
Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Source: Human papillomavirus type 16
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Application Notes: Biological Origin: Human papillomavirus type 16. Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized HPV16 E7 at 10 µg/mL can bind Biotinylated MYC, the EC50 is 268.1-354.3 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized HPV16 E7 at 10 µg/ml can bind Biotinylated MYC, the EC50 is 268.1-354.3 ng/mL.