Recombinant Human Glypican-3 (GPC3) (G537R), partial (Active)

Catalog Number: BYT-ORB1095881
Article Name: Recombinant Human Glypican-3 (GPC3) (G537R), partial (Active)
Biozol Catalog Number: BYT-ORB1095881
Supplier Catalog Number: orb1095881
Alternative Catalog Number: BYT-ORB1095881-1,BYT-ORB1095881-100,BYT-ORB1095881-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
This Recombinant Human Glypican-3 (GPC3) (G537R), partial (Active) spans the amino acid sequence from region 25-559aa(G537R). Purity: Greater than 92.4% as determined by SDS-PAGE.
Molecular Weight: 65 kDa
UniProt: P51654
Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Source: Homo sapiens (Human)
Purity: Greater than 92.4% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: QPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCN
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human GPC3 (G537R) at 5 µg/ml can bind Anti-GPC3 recombinant antibody, the EC50 is 4.739-7.092 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized human GPC3 (G537R) at 5 µg/ml can bind Anti-GPC3 recombinant antibody, the EC50 is 4.739-7.092 ng/ml.