Recombinant Human Leukemia inhibitory factor (LIF) (Active)

Product Overview

• Article Name: Recombinant Human Leukemia inhibitory factor (LIF) (Active)
• Biozol Catalog Number: BYT-ORB1095883
• Supplier Catalog Number: orb1095883
• Alternative Catalog Number: BYT-ORB1095883-1,BYT-ORB1095883-100,BYT-ORB1095883-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

This Recombinant Human Leukemia inhibitory factor (LIF) (Active) spans the amino acid sequence from region 23-202aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 48.6 kDa
• UniProt: P15018
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human LIF at 2 µg/ml can bind human LIFR, the EC50 is 22.58-30.24 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

orb1095883

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized human LIF at 2 µg/ml can bind human LIFR, the EC50 is 22.58-30.24 ng/ml.