Recombinant Human Tumor necrosis factor ligand superfamily member 14 (TNFSF14), partial, Biotinylated (Active)

Catalog Number: BYT-ORB1095892
Article Name: Recombinant Human Tumor necrosis factor ligand superfamily member 14 (TNFSF14), partial, Biotinylated (Active)
Biozol Catalog Number: BYT-ORB1095892
Supplier Catalog Number: orb1095892
Alternative Catalog Number: BYT-ORB1095892-1,BYT-ORB1095892-100,BYT-ORB1095892-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
This Recombinant Human Tumor necrosis factor ligand superfamily member 14 (TNFSF14), partial, Biotinylated (Active) spans the amino acid sequence from region 74-240aa. Purity: Greater than 92% as determined by SDS-PAGE.
Molecular Weight: 47.3 kDa
UniProt: O43557
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Homo sapiens (Human)
Purity: Greater than 92% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF14 at 5 µg/ml can bind Biotinylated human TNFSF14, the EC50 is 1.773-3.707 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
orb1095892
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF14 at 5 µg/ml can bind Biotinylated human TNFSF14, the EC50 is 1.773-3.707 ng/ml.