Recombinant Human CD226 antigen (CD226), partial (Active)

Product Overview

• Article Name: Recombinant Human CD226 antigen (CD226), partial (Active)
• Biozol Catalog Number: BYT-ORB1095901
• Supplier Catalog Number: orb1095901
• Alternative Catalog Number: BYT-ORB1095901-1,BYT-ORB1095901-100,BYT-ORB1095901-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

This Recombinant Human CD226 antigen (CD226), partial (Active) spans the amino acid sequence from region 19-247aa. Purity: Greater than 93% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 56.1 kDa
• UniProt: Q15762
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Homo sapiens (Human)
• Purity: Greater than 93% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: FACS assay shows that Human CD226 can bind to 293F cell overexpressing human CD155. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

FACS assay shows that Human CD226 can bind to 293F cell overexpressing human CD155.