Recombinant Human T-cell antigen CD7 (CD7), partial (Active)

Product Overview

• Article Name: Recombinant Human T-cell antigen CD7 (CD7), partial (Active)
• Biozol Catalog Number: BYT-ORB1095903
• Supplier Catalog Number: orb1095903
• Alternative Catalog Number: BYT-ORB1095903-1,BYT-ORB1095903-100,BYT-ORB1095903-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

This Recombinant Human T-cell antigen CD7 (CD7), partial (Active) spans the amino acid sequence from region 26-180aa. Purity: Greater than 94.5% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 46.5 kDa
• UniProt: P09564
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Homo sapiens (Human)
• Purity: Greater than 94.5% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 µg/ml can bind SECTM1, the EC50 is 1.236-1.773 ng/ml.

Human CD7 protein hFc and Myc tag captured on COOH chip can bind Human SECTM1 protein hFc tag with an affinity constant of 1.84 nM as detected by LSPR Assay.

The purity of CD7 was greater than 95% as determined by SEC-HPLC