Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial

Catalog Number: BYT-ORB1096464
Article Name: Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial
Biozol Catalog Number: BYT-ORB1096464
Supplier Catalog Number: orb1096464
Alternative Catalog Number: BYT-ORB1096464-1,BYT-ORB1096464-100,BYT-ORB1096464-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Glucose-dependent insulinotropic polypeptide receptor
This Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial spans the amino acid sequence from region 19-134aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 20.8 kDa
UniProt: Q0P543
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
SDS-Page analysis of Recombinant Mouse Gastric inhibitory polypeptide receptor(Gipr),partial.