Recombinant Human Endoplasmin (HSP90B1), partial

Catalog Number: BYT-ORB1096583
Article Name: Recombinant Human Endoplasmin (HSP90B1), partial
Biozol Catalog Number: BYT-ORB1096583
Supplier Catalog Number: orb1096583
Alternative Catalog Number: BYT-ORB1096583-20,BYT-ORB1096583-100,BYT-ORB1096583-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 94KDA glucose-regulated protein , GRP-94Heat shock protein 90KDA beta member 1Tumor rejection antigen 1gp96 homolog
This Recombinant Human Endoplasmin (HSP90B1), partial spans the amino acid sequence from region 27-799aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 93.1 kDa
UniProt: P14625
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYV
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HSP90B1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HSP90B1.