P9R
Catalog Number:
BYT-ORB1140591
| Article Name: |
P9R |
| Biozol Catalog Number: |
BYT-ORB1140591 |
| Supplier Catalog Number: |
orb1140591 |
| Alternative Catalog Number: |
BYT-ORB1140591-1 |
| Manufacturer: |
Biorbyt |
| Category: |
Proteine/Peptide |
| Alternative Names: |
MERS-CoV CV060, NGAICWGPCPTAFRQIGNCGRFRVRCCRIR, P9R, SARS-CoV, SARS-CoV-2, antiviral activity, avian influenza, coronavirus, defensin, peptide, rhinovirus |
| Defensin like peptide with potent antiviral activity, Antimicrobial peptides. |
| Molecular Weight: |
3412.1 Da |
| Purity: |
> 95% by HPLC |
| Form: |
Freeze dried solid |
| Sequence: |
H-Asn-Gly-Ala-Ile-Cys-Trp-Gly-Pro-Cys-Pro-Thr-Ala-Phe-Arg-Gln-Ile-Gly-Asn-Cys-Gly-Arg-Phe-Arg-Val-Arg-Cys-Cys-Arg-Ile-Arg-OH |
| Formula: |
C144H232N52O35S5 |
| Application Notes: |
Solubility: Soluble to 5 mg/ml in water |
