SARS-CoV-2 (COVID-19) Trimeric Spike (S) Recombinant Protein Preis auf Anfrage

Product Overview

• Article Name: SARS-CoV-2 (COVID-19) Trimeric Spike (S) Recombinant Protein Preis auf Anfrage
• Biozol Catalog Number: BYT-ORB1231621
• Supplier Catalog Number: orb1231621
• Alternative Catalog Number: BYT-ORB1231621-0.1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: ELISA
• Alternative Names: covid-19, sars-cov-2

Product Description

SARS-CoV-2 (COVID-19) Trimeric Spike (S) Recombinant Protein

Product Properties

• Molecular Weight: The predicted molecular mass is ~132 kDa for monomer and ~396 kDa for trimer
• NCBI: 43416
• Buffer: This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added.
• Purity: >95% by SDS Page Endotoxin level 1.0 EU/mg as determined by the LAL method
• Form: Liquid
• Sequence: QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTN GTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFC NDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFK NIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWT AGAAA

Application Notes

• Application Notes: Application Notes: ELISA

Images

Purified SARS-CoV-2 Trimeric Spike (S) Protein under non-reducing conditions. Lane 1-Trimeric Spike protein loaded at 10 µg, runs as a monomer in the presence of SDS