ORF7a (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal

Catalog Number: BYT-ORB1463307
Article Name: ORF7a (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal
Biozol Catalog Number: BYT-ORB1463307
Supplier Catalog Number: orb1463307
Alternative Catalog Number: BYT-ORB1463307-100
Manufacturer: Biorbyt
Host: Goat
Category: Antikörper
Application: WB
Species Reactivity: Virus
Immunogen: Antigen: Affinity purified recombinant fusion protein ORF7a (residues 18 to 95) produced in E. coli.. Antigen Sequence: MYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQE
Conjugation: Unconjugated
Alternative Names: ORF7a SARS Coronavirus-2 antibody., sars-cov-2
ORF7a is a SARS-CoV accessory protein that is composed of a type I transmembrane protein that localizes primarily to the Golgi apparatus and also be found on the cell surface. This protein has been implicated on several mechanisms such as suppressing both transgene and virus-induced gene silencing by reducing the levels of small interfering RNA (siRNA), attachment and modulation of leukocytes by biding to host ITGAL and playing a role as antagonist of host tetherin (BST2) by disrupting its antiviral effect.
Clonality: Polyclonal
Concentration: 1 mg/ml
Buffer: PBS, 20% glycerol and 0.05% sodium azide
Target: ORF7a (SARS-CoV-2)
Application Dilute: WB:1:500-1:2,000
Application Notes: The antibody solution should be gently mixed before use.