NSP16 (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal

Catalog Number: BYT-ORB1463315
Article Name: NSP16 (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal
Biozol Catalog Number: BYT-ORB1463315
Supplier Catalog Number: orb1463315
Alternative Catalog Number: BYT-ORB1463315-100
Manufacturer: Biorbyt
Host: Goat
Category: Antikörper
Application: WB
Species Reactivity: Virus
Immunogen: Antigen: Affinity purified recombinant fusion protein using the N-terminal of Nsp16 (residues 1 to 140) and produced in E. coli. Antigen Sequence: MSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNV
Conjugation: Unconjugated
Alternative Names: Nsp16 SARS Coronavirus-2 antibody., methyltransferase, sars-cov-2
Nsp16 is part of the multifunctional protein replicase polyprotein 1ab that is involved in the transcription and replication of viral RNA. This non-structural protein has methyltransferase activity playing an essential role in viral mRNAs cap methylation which is essential to evade immune system.
Clonality: Polyclonal
Concentration: 1 mg/ml
Buffer: PBS, 20% glycerol and 0.05% sodium azide
Target: NSP16 (SARS-CoV-2)
Application Dilute: WB:1:500-1:2,000
Application Notes: Application Notes: The antibody solution should be gently mixed before use